Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries) |
Domain d2qtnb_: 2qtn B: [167798] automated match to d1kama_ complexed with gol, mg, ncn |
PDB Entry: 2qtn (more details), 2.4 Å
SCOPe Domain Sequences for d2qtnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtnb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrditsvesrlqml elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy iernglyes
Timeline for d2qtnb_: