Lineage for d2qtma_ (2qtm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860402Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2860403Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries)
  8. 2860411Domain d2qtma_: 2qtm A: [167795]
    automated match to d1kama_
    complexed with co, gol

Details for d2qtma_

PDB Entry: 2qtm (more details), 2.4 Å

PDB Description: crystal structure of nicotinate mononucleotide adenylyltransferase
PDB Compounds: (A:) Nicotinate (Nicotinamide) nucleotide adenylyltransferase

SCOPe Domain Sequences for d2qtma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrditsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes

SCOPe Domain Coordinates for d2qtma_:

Click to download the PDB-style file with coordinates for d2qtma_.
(The format of our PDB-style files is described here.)

Timeline for d2qtma_: