Lineage for d2qrwj_ (2qrw J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685880Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2685881Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 2685907Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (2 PDB entries)
  8. 2685929Domain d2qrwj_: 2qrw J: [167789]
    automated match to d1ngkb_
    complexed with cyn, hem, so4; mutant

Details for d2qrwj_

PDB Entry: 2qrw (more details), 1.93 Å

PDB Description: crystal structure of mycobacterium tuberculosis trhbo wg8f mutant
PDB Compounds: (J:) Hemoglobin-like protein HbO

SCOPe Domain Sequences for d2qrwj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qrwj_ a.1.1.1 (J:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}
ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs
lvnspf

SCOPe Domain Coordinates for d2qrwj_:

Click to download the PDB-style file with coordinates for d2qrwj_.
(The format of our PDB-style files is described here.)

Timeline for d2qrwj_: