Lineage for d2qrwg_ (2qrw G:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473063Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1473064Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1473090Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (2 PDB entries)
  8. 1473097Domain d2qrwg_: 2qrw G: [167786]
    automated match to d1ngkb_
    complexed with cyn, hem, so4; mutant

Details for d2qrwg_

PDB Entry: 2qrw (more details), 1.93 Å

PDB Description: crystal structure of mycobacterium tuberculosis trhbo wg8f mutant
PDB Compounds: (G:) Hemoglobin-like protein HbO

SCOPe Domain Sequences for d2qrwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qrwg_ a.1.1.1 (G:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}
pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
slvnspf

SCOPe Domain Coordinates for d2qrwg_:

Click to download the PDB-style file with coordinates for d2qrwg_.
(The format of our PDB-style files is described here.)

Timeline for d2qrwg_: