Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (2 PDB entries) |
Domain d2qrwd_: 2qrw D: [167783] automated match to d1ngkb_ complexed with cyn, hem, so4; mutant |
PDB Entry: 2qrw (more details), 1.93 Å
SCOPe Domain Sequences for d2qrwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qrwd_ a.1.1.1 (D:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]} ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs lvnspf
Timeline for d2qrwd_: