Lineage for d2qrwc_ (2qrw C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253687Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1253688Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1253714Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (2 PDB entries)
  8. 1253717Domain d2qrwc_: 2qrw C: [167782]
    automated match to d1ngkb_
    complexed with cyn, hem, so4; mutant

Details for d2qrwc_

PDB Entry: 2qrw (more details), 1.93 Å

PDB Description: crystal structure of mycobacterium tuberculosis trhbo wg8f mutant
PDB Compounds: (C:) Hemoglobin-like protein HbO

SCOPe Domain Sequences for d2qrwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qrwc_ a.1.1.1 (C:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}
pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
slvnspf

SCOPe Domain Coordinates for d2qrwc_:

Click to download the PDB-style file with coordinates for d2qrwc_.
(The format of our PDB-style files is described here.)

Timeline for d2qrwc_: