Lineage for d2qrfa_ (2qrf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2508393Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2508399Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (203 PDB entries)
    Uniprot P42212
  8. 2508472Domain d2qrfa_: 2qrf A: [167779]
    automated match to d1qyqa_
    complexed with edo, mg

Details for d2qrfa_

PDB Entry: 2qrf (more details), 1.5 Å

PDB Description: Green Fluorescent Protein: Cyclized-only Intermediate of Chromophore Maturation in the Q183E variant
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2qrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qrfa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlxvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyeq
ntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d2qrfa_:

Click to download the PDB-style file with coordinates for d2qrfa_.
(The format of our PDB-style files is described here.)

Timeline for d2qrfa_: