| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily) duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich |
Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) ![]() two chains result from self-processing single-chain precursor; form heterohexamer |
| Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins) |
| Protein automated matches [190911] (1 species) not a true protein |
| Species Methanocaldococcus jannaschii [TaxId:2190] [188381] (1 PDB entry) |
| Domain d2qqdc_: 2qqd C: [167773] automated match to d1n2mc_ complexed with ag2, mpd, pyr; mutant |
PDB Entry: 2qqd (more details), 2 Å
SCOPe Domain Sequences for d2qqdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qqdc_ d.155.1.2 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
plhayfklpntvslvagssegetplnafdgallnagignvalirissimppeaeivplpk
lpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvrem
akigfemrgweldriesiavehtveklgcafaaaalwyk
Timeline for d2qqdc_: