Lineage for d2qq4c_ (2qq4 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446741Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1446742Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1446784Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 1446785Protein automated matches [190942] (3 species)
    not a true protein
  7. 1446794Species Thermus thermophilus [TaxId:274] [188505] (1 PDB entry)
  8. 1446797Domain d2qq4c_: 2qq4 C: [167765]
    automated match to d1xjsa_
    complexed with zn

Details for d2qq4c_

PDB Entry: 2qq4 (more details), 1.85 Å

PDB Description: crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8
PDB Compounds: (C:) Iron-sulfur cluster biosynthesis protein IscU

SCOPe Domain Sequences for d2qq4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qq4c_ d.224.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
msvldelyreilldhyqsprnfgvlpqatkqaggmnpscgdqvevmvllegdtiadirfq
gqgcaistasaslmteavkgkkvaealelsrkfqamvvegappdptlgdllalqgvaklp
arvkcatlawhaleealr

SCOPe Domain Coordinates for d2qq4c_:

Click to download the PDB-style file with coordinates for d2qq4c_.
(The format of our PDB-style files is described here.)

Timeline for d2qq4c_: