Lineage for d1fz5a_ (1fz5 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536385Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 536413Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 536414Species Methylococcus capsulatus [TaxId:414] [88790] (15 PDB entries)
  8. 536437Domain d1fz5a_: 1fz5 A: [16776]
    Other proteins in same PDB: d1fz5c_, d1fz5d_, d1fz5e_, d1fz5f_

Details for d1fz5a_

PDB Entry: 1fz5 (more details), 2.4 Å

PDB Description: methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme

SCOP Domain Sequences for d1fz5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz5a_ a.25.1.2 (A:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus}
nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
aqphvrgdklwtlddikrlncvfknpvkafn

SCOP Domain Coordinates for d1fz5a_:

Click to download the PDB-style file with coordinates for d1fz5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fz5a_: