![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.1: MogA-like [53219] (6 proteins) |
![]() | Protein MogA [53220] (3 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [188504] (1 PDB entry) |
![]() | Domain d2qq1c_: 2qq1 C: [167759] automated match to d2f7wa1 |
PDB Entry: 2qq1 (more details), 1.9 Å
SCOPe Domain Sequences for d2qq1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qq1c_ c.57.1.1 (C:) MogA {Aquifex aeolicus [TaxId: 63363]} kkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliel adekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqta girgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrp
Timeline for d2qq1c_: