Lineage for d2qq1c_ (2qq1 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127256Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2127257Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2127258Family c.57.1.1: MogA-like [53219] (6 protein domains)
  6. 2127276Protein MogA [53220] (3 species)
  7. 2127277Species Aquifex aeolicus [TaxId:63363] [188504] (1 PDB entry)
  8. 2127280Domain d2qq1c_: 2qq1 C: [167759]
    automated match to d2f7wa1

Details for d2qq1c_

PDB Entry: 2qq1 (more details), 1.9 Å

PDB Description: Crystal Structure Of Molybdenum Cofactor Biosynthesis (aq_061) Other Form From Aquifex Aeolicus Vf5
PDB Compounds: (C:) Molybdenum cofactor biosynthesis MOG

SCOPe Domain Sequences for d2qq1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qq1c_ c.57.1.1 (C:) MogA {Aquifex aeolicus [TaxId: 63363]}
kkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliel
adekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqta
girgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrp

SCOPe Domain Coordinates for d2qq1c_:

Click to download the PDB-style file with coordinates for d2qq1c_.
(The format of our PDB-style files is described here.)

Timeline for d2qq1c_: