SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qq1c_ (2qq1 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127256Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2127257Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2127258Family c.57.1.1: MogA-like [53219] (6 protein domains)
  6. 2127276Protein MogA [53220] (3 species)
  7. 2127277Species Aquifex aeolicus [TaxId:63363] [188504] (1 PDB entry)
  8. 2127280Domain d2qq1c_: 2qq1 C: [167759]
    automated match to d2f7wa1

Details for d2qq1c_

PDB Entry: 2qq1 (more details), 1.9 Å

PDB Description: Crystal Structure Of Molybdenum Cofactor Biosynthesis (aq_061) Other Form From Aquifex Aeolicus Vf5
PDB Compounds: (C:) Molybdenum cofactor biosynthesis MOG

SCOPe Domain Sequences for d2qq1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qq1c_ c.57.1.1 (C:) MogA {Aquifex aeolicus [TaxId: 63363]}
kkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliel
adekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqta
girgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrp

SCOPe Domain Coordinates for d2qq1c_:

Click to download the PDB-style file with coordinates for d2qq1c_.
(The format of our PDB-style files is described here.)

Timeline for d2qq1c_: