SCOPe 2.01: Domain d2qq1b_: 2qq1 B:

Lineage for d2qq1b_ (2qq1 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 proteins)

6. Protein MogA [53220] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [188504] (1 PDB entry)

8. Domain d2qq1b_: 2qq1 B: [167758]
   automated match to d2f7wa1

Details for d2qq1b_

PDB Entry: 2qq1, 1.9 Å

PDB Description: Crystal Structure Of Molybdenum Cofactor Biosynthesis (aq_061) Other Form From Aquifex Aeolicus Vf5

PDB Compounds: (B:) Molybdenum cofactor biosynthesis MOG

SCOPe Domain Sequences for d2qq1b_:

Sequence; same for both SEQRES and ATOM records:

>d2qq1b_ c.57.1.1 (B:) MogA {Aquifex aeolicus [TaxId: 63363]}
kkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliel
adekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqta
girgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrp

Timeline for d2qq1b_:

• d2qq1b_ is new in SCOPe 2.01-stable
  
• d2qq1b_ appears in SCOPe 2.02
  
• d2qq1b_ appears in the current release, SCOPe 2.08