Lineage for d2qpfg_ (2qpf G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2768959Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2769670Species Mouse (Mus musculus) [TaxId:10090] [188281] (1 PDB entry)
  8. 2769677Domain d2qpfg_: 2qpf G: [167754]
    automated match to d1kgja_

Details for d2qpfg_

PDB Entry: 2qpf (more details), 2.05 Å

PDB Description: Crystal Structure of Mouse Transthyretin
PDB Compounds: (G:) Transthyretin

SCOPe Domain Sequences for d2qpfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpfg_ b.3.4.1 (G:) Transthyretin (synonym: prealbumin) {Mouse (Mus musculus) [TaxId: 10090]}
cplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegvy
rveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvs

SCOPe Domain Coordinates for d2qpfg_:

Click to download the PDB-style file with coordinates for d2qpfg_.
(The format of our PDB-style files is described here.)

Timeline for d2qpfg_: