| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
| Protein Transthyretin (synonym: prealbumin) [49474] (5 species) sandwich; 8 strands in 2 sheets |
| Species Mouse (Mus musculus) [TaxId:10090] [188281] (1 PDB entry) |
| Domain d2qpfe_: 2qpf E: [167752] automated match to d1kgja_ |
PDB Entry: 2qpf (more details), 2.05 Å
SCOPe Domain Sequences for d2qpfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpfe_ b.3.4.1 (E:) Transthyretin (synonym: prealbumin) {Mouse (Mus musculus) [TaxId: 10090]}
kcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegv
yrveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvsn
Timeline for d2qpfe_: