SCOPe 2.03: Domain d2qpfd_: 2qpf D:

Lineage for d2qpfd_ (2qpf D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Mouse (Mus musculus) [TaxId:10090] [188281] (1 PDB entry)

8. Domain d2qpfd_: 2qpf D: [167751]
   automated match to d1kgja_

Details for d2qpfd_

PDB Entry: 2qpf, 2.05 Å

PDB Description: Crystal Structure of Mouse Transthyretin

PDB Compounds: (D:) Transthyretin

SCOPe Domain Sequences for d2qpfd_:

Sequence; same for both SEQRES and ATOM records:

>d2qpfd_ b.3.4.1 (D:) Transthyretin (synonym: prealbumin) {Mouse (Mus musculus) [TaxId: 10090]}
cplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegvy
rveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvs

Timeline for d2qpfd_:

• d2qpfd_ first appeared in SCOPe 2.01
  
• d2qpfd_ appears in SCOPe 2.02
  
• d2qpfd_ appears in SCOPe 2.04
  
• d2qpfd_ appears in the current release, SCOPe 2.08