Lineage for d2qp3a_ (2qp3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109948Protein Hydroxysteroid sulfotransferase sult2a1 [52578] (1 species)
  7. 2109949Species Human (Homo sapiens) [TaxId:9606] [52579] (6 PDB entries)
  8. 2109957Domain d2qp3a_: 2qp3 A: [167747]
    automated match to d1j99a_
    complexed with aox

Details for d2qp3a_

PDB Entry: 2qp3 (more details), 2.6 Å

PDB Description: identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
PDB Compounds: (A:) Bile salt sulfotransferase

SCOPe Domain Sequences for d2qp3a_:

Sequence, based on SEQRES records: (download)

>d2qp3a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]}
sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
nprdvlvsgyffwknikfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvd
ktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe

Sequence, based on observed residues (ATOM records): (download)

>d2qp3a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]}
sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
nprdvlvsgyffwknikfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkeyvvdktqlsgdwknhf
tvaqaedfdklfqekmadlprelfpwe

SCOPe Domain Coordinates for d2qp3a_:

Click to download the PDB-style file with coordinates for d2qp3a_.
(The format of our PDB-style files is described here.)

Timeline for d2qp3a_: