SCOPe 2.06: Domain d2qogc_: 2qog C:

Lineage for d2qogc_ (2qog C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Crotalus durissus [TaxId:8732] [188410] (2 PDB entries)

8. Domain d2qogc_: 2qog C: [167743]
   automated match to d1a2aa_
   complexed with ca

Details for d2qogc_

PDB Entry: 2qog, 2.28 Å

PDB Description: Crotoxin B, the basic PLA2 from Crotalus durissus terrificus.

PDB Compounds: (C:) Phospholipase A2 CB1

SCOPe Domain Sequences for d2qogc_:

Sequence; same for both SEQRES and ATOM records:

>d2qogc_ a.133.1.2 (C:) automated matches {Crotalus durissus [TaxId: 8732]}
hllqfnkmikfetrknaipfyafygcycgwggrgrpkdatdrccfvhdccygklakcntk
wdiypyslksgyitcgkgtwceeqicecdrvaaeclrrslstykygymfypdsrcrgpse
tc

Timeline for d2qogc_:

• d2qogc_ first appeared in SCOPe 2.01
  
• d2qogc_ appears in SCOPe 2.05
  
• d2qogc_ appears in SCOPe 2.07
  
• d2qogc_ appears in the current release, SCOPe 2.08