![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Crotalus durissus [TaxId:8732] [188410] (3 PDB entries) |
![]() | Domain d2qoga_: 2qog A: [167741] automated match to d1bjja_ complexed with ca |
PDB Entry: 2qog (more details), 2.28 Å
SCOPe Domain Sequences for d2qoga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoga_ a.133.1.2 (A:) automated matches {Crotalus durissus [TaxId: 8732]} sllqfnkmikfetrknavpfyafygcycgwggqgrpkdatdrccfvhdccygklakcntk wdiyryslksgyitcgkgtwckeqicecdrvaaeclrrslstykneymfypdsrcrepse tc
Timeline for d2qoga_: