SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qo6a_ (2qo6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063396Species Zebrafish (Danio rerio) [TaxId:7955] [188008] (3 PDB entries)
  8. 2063399Domain d2qo6a_: 2qo6 A: [167740]
    automated match to d1mvga_
    complexed with chd, gol, ipa; mutant

Details for d2qo6a_

PDB Entry: 2qo6 (more details), 1.9 Å

PDB Description: Crystal structure of the glycine 55 arginine mutant of zebrafish liver bile acid-binding protein complexed with cholic acid
PDB Compounds: (A:) Liver-basic fatty acid binding protein

SCOPe Domain Sequences for d2qo6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qo6a_ b.60.1.2 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
afsgtwqvyaqenyeeflraislpeeviklakdvkpvteiqqngsdftitsktprktvtn
sftigkeaeittmdgkklkcivkldggklvcrtdrfshiqeikagemvetltvggttmir
kskki

SCOPe Domain Coordinates for d2qo6a_:

Click to download the PDB-style file with coordinates for d2qo6a_.
(The format of our PDB-style files is described here.)

Timeline for d2qo6a_: