Lineage for d1fz4c_ (1fz4 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316654Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 2316655Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 2316698Domain d1fz4c_: 1fz4 C: [16774]
    Other proteins in same PDB: d1fz4a_, d1fz4b_, d1fz4e_, d1fz4f_
    complexed with ca, fe, fmt

Details for d1fz4c_

PDB Entry: 1fz4 (more details), 2.38 Å

PDB Description: methane monooxygenase hydroxylase, form iii soaked at ph 8.5 (0.1 m tris)
PDB Compounds: (C:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz4c_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1fz4c_:

Click to download the PDB-style file with coordinates for d1fz4c_.
(The format of our PDB-style files is described here.)

Timeline for d1fz4c_: