SCOPe 2.06: Domain d2qo5a1: 2qo5 A:1-125

Lineage for d2qo5a1 (2qo5 A:1-125)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188008] (3 PDB entries)

8. Domain d2qo5a1: 2qo5 A:1-125 [167739]
   Other proteins in same PDB: d2qo5a2, d2qo5a3
   automated match to d1mvga_
   complexed with chd; mutant

Details for d2qo5a1

PDB Entry: 2qo5, 1.5 Å

PDB Description: crystal structure of the cysteine 91 threonine mutant of zebrafish liver bile acid-binding protein complexed with cholic acid

PDB Compounds: (A:) Liver-basic fatty acid binding protein

SCOPe Domain Sequences for d2qo5a1:

Sequence; same for both SEQRES and ATOM records:

>d2qo5a1 b.60.1.2 (A:1-125) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
afsgtwqvyaqenyeeflraislpeeviklakdvkpvteiqqngsdftitsktpgktvtn
sftigkeaeittmdgkklkcivkldggklvtrtdrfshiqeikagemvetltvggttmir
kskki

Timeline for d2qo5a1:

• d2qo5a1 first appeared in SCOPe 2.01, called d2qo5a_
  
• d2qo5a1 was called d2qo5a_ in SCOPe 2.05
  
• d2qo5a1 appears in SCOPe 2.07
  
• d2qo5a1 appears in the current release, SCOPe 2.08