Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein automated matches [190295] (3 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [188008] (3 PDB entries) |
Domain d2qo4a_: 2qo4 A: [167738] automated match to d2ft9a1 complexed with chd, gol, ipa |
PDB Entry: 2qo4 (more details), 1.5 Å
SCOPe Domain Sequences for d2qo4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qo4a_ b.60.1.2 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} afsgtwqvyaqenyeeflraislpeeviklakdvkpvteiqqngsdftitsktpgktvtn sftigkeaeittmdgkklkcivkldggklvcrtdrfshiqeikagemvetltvggttmir kskki
Timeline for d2qo4a_: