SCOPe 2.01: Domain d2qo4a_: 2qo4 A:

Lineage for d2qo4a_ (2qo4 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (3 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188008] (3 PDB entries)

8. Domain d2qo4a_: 2qo4 A: [167738]
   automated match to d2ft9a1
   complexed with chd, gol, ipa

Details for d2qo4a_

PDB Entry: 2qo4, 1.5 Å

PDB Description: Crystal structure of zebrafish liver bile acid-binding protein complexed with cholic acid

PDB Compounds: (A:) Liver-basic fatty acid binding protein

SCOPe Domain Sequences for d2qo4a_:

Sequence; same for both SEQRES and ATOM records:

>d2qo4a_ b.60.1.2 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
afsgtwqvyaqenyeeflraislpeeviklakdvkpvteiqqngsdftitsktpgktvtn
sftigkeaeittmdgkklkcivkldggklvcrtdrfshiqeikagemvetltvggttmir
kskki

Timeline for d2qo4a_:

• d2qo4a_ is new in SCOPe 2.01-stable
  
• d2qo4a_ appears in SCOPe 2.02
  
• d2qo4a_ appears in the current release, SCOPe 2.08