Lineage for d2qnwa_ (2qnw A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731062Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1731063Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1731068Protein Acyl carrier protein [47338] (6 species)
  7. 1731108Species Toxoplasma gondii [TaxId:383379] [188007] (1 PDB entry)
  8. 1731109Domain d2qnwa_: 2qnw A: [167737]
    automated match to d1acpa_
    complexed with na, so4, zn

Details for d2qnwa_

PDB Entry: 2qnw (more details), 1.9 Å

PDB Description: Toxoplasma gondii apicoplast-targeted acyl carrier protein
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2qnwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnwa_ a.28.1.1 (A:) Acyl carrier protein {Toxoplasma gondii [TaxId: 383379]}
sddrpllervkdvvadqlgvdrarinpesnfikdldadsldsvelvmafeekfgvsipde
easkiatvqdalsyiekaks

SCOPe Domain Coordinates for d2qnwa_:

Click to download the PDB-style file with coordinates for d2qnwa_.
(The format of our PDB-style files is described here.)

Timeline for d2qnwa_: