Lineage for d2qmhe_ (2qmh E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1877881Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 1877882Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 1877965Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
    automatically mapped to Pfam PF07475
  6. 1877966Protein HPr kinase HprK C-terminal domain [64187] (3 species)
  7. 1877967Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries)
  8. 1877978Domain d2qmhe_: 2qmh E: [167728]
    automated match to d1kklc_
    mutant

Details for d2qmhe_

PDB Entry: 2qmh (more details), 2.6 Å

PDB Description: structure of v267f mutant hprk/p
PDB Compounds: (E:) HPr kinase/phosphorylase

SCOPe Domain Sequences for d2qmhe_:

Sequence, based on SEQRES records: (download)

>d2qmhe_ c.91.1.2 (E:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
ifdvpvpkitvpfkvgrnlaiiievaamnfraksmgydatktfeknlnhliehne

Sequence, based on observed residues (ATOM records): (download)

>d2qmhe_ c.91.1.2 (E:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlensgeqtqlifdvpvpkitv
pfkvgrnlaiiievaamnfraksmgydatktfeknlnhliehne

SCOPe Domain Coordinates for d2qmhe_:

Click to download the PDB-style file with coordinates for d2qmhe_.
(The format of our PDB-style files is described here.)

Timeline for d2qmhe_: