Lineage for d2qmhb_ (2qmh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912052Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2912053Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2912166Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
    automatically mapped to Pfam PF07475
  6. 2912167Protein HPr kinase HprK C-terminal domain [64187] (3 species)
  7. 2912168Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries)
  8. 2912176Domain d2qmhb_: 2qmh B: [167725]
    automated match to d1kklc_
    mutant

Details for d2qmhb_

PDB Entry: 2qmh (more details), 2.6 Å

PDB Description: structure of v267f mutant hprk/p
PDB Compounds: (B:) HPr kinase/phosphorylase

SCOPe Domain Sequences for d2qmhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmhb_ c.91.1.2 (B:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
qlaerrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqti
vgaappilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeq
tqlifdvpvpkitvpfkvgrnlaiiievaamnfraksmgydatktfeknlnhliehneet
d

SCOPe Domain Coordinates for d2qmhb_:

Click to download the PDB-style file with coordinates for d2qmhb_.
(The format of our PDB-style files is described here.)

Timeline for d2qmhb_: