Lineage for d2qlka_ (2qlk A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041113Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2041114Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2041329Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2041330Protein automated matches [190378] (6 species)
    not a true protein
  7. 2041351Species Human adenovirus 35 [TaxId:10522] [188348] (2 PDB entries)
  8. 2041352Domain d2qlka_: 2qlk A: [167713]
    automated match to d2o39a1
    complexed with gol

Details for d2qlka_

PDB Entry: 2qlk (more details), 2.02 Å

PDB Description: adenovirus ad35 fibre head
PDB Compounds: (A:) Fiber

SCOPe Domain Sequences for d2qlka_:

Sequence, based on SEQRES records: (download)

>d2qlka_ b.21.1.0 (A:) automated matches {Human adenovirus 35 [TaxId: 10522]}
sintlwtginpppncqiventntndgkltlvlvkngglvngyvslvgvsdtvnqmftqkt
aniqlrlyfdssgnllteesdlkiplknksstatsetvasskafmpsttaypfntttrds
enyihgicyymtsydrslfplnisimlnsrmissnvayaiqfewnlnasespesniatlt
tspfffsyited

Sequence, based on observed residues (ATOM records): (download)

>d2qlka_ b.21.1.0 (A:) automated matches {Human adenovirus 35 [TaxId: 10522]}
sintlwtginpppncqiventntndgkltlvlvkngglvngyvslvgvsdtvnqmftqkt
aniqlrlyfdssgnllteesdlkiplknkssskafmpsttaypfntttrdsenyihgicy
ymtsydrslfplnisimlnsrmissnvayaiqfewnlnasespesniatlttspfffsyi
ted

SCOPe Domain Coordinates for d2qlka_:

Click to download the PDB-style file with coordinates for d2qlka_.
(The format of our PDB-style files is described here.)

Timeline for d2qlka_: