Lineage for d2qlia_ (2qli A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2184845Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries)
  8. 2184852Domain d2qlia_: 2qli A: [167711]
    automated match to d1g7ka_
    mutant

Details for d2qlia_

PDB Entry: 2qli (more details), 1.34 Å

PDB Description: mplum e16q mutant
PDB Compounds: (A:) Fluorescent protein plum

SCOPe Domain Sequences for d2qlia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlia_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
evikefmrfkqhmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk
pvqlpgayktdiklditshnedytiveqyeraegrhs

SCOPe Domain Coordinates for d2qlia_:

Click to download the PDB-style file with coordinates for d2qlia_.
(The format of our PDB-style files is described here.)

Timeline for d2qlia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qlib_