Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries) |
Domain d2qlia_: 2qli A: [167711] automated match to d1g7ka_ mutant |
PDB Entry: 2qli (more details), 1.34 Å
SCOPe Domain Sequences for d2qlia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qlia_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]} evikefmrfkqhmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk pvqlpgayktdiklditshnedytiveqyeraegrhs
Timeline for d2qlia_: