Lineage for d2qlgb_ (2qlg B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199423Species Discosoma sp. [TaxId:301246] [188540] (5 PDB entries)
  8. 1199426Domain d2qlgb_: 2qlg B: [167708]
    automated match to d1g7ka_

Details for d2qlgb_

PDB Entry: 2qlg (more details), 1.8 Å

PDB Description: mPlum
PDB Compounds: (B:) Fluorescent protein plum

SCOPe Domain Sequences for d2qlgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlgb_ d.22.1.1 (B:) automated matches {Discosoma sp. [TaxId: 301246]}
evikefmrfkehmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk
pvqlpgayktdiklditshnedytiveqyeraegrhstg

SCOPe Domain Coordinates for d2qlgb_:

Click to download the PDB-style file with coordinates for d2qlgb_.
(The format of our PDB-style files is described here.)

Timeline for d2qlgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qlga_