Lineage for d2qled_ (2qle D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547313Species Azotobacter vinelandii [TaxId:354] [188536] (1 PDB entry)
  8. 2547317Domain d2qled_: 2qle D: [167706]
    Other proteins in same PDB: d2qlea2
    automated match to d1qyoa_
    complexed with imd; mutant

Details for d2qled_

PDB Entry: 2qle (more details), 1.59 Å

PDB Description: gfp/s205v mutant
PDB Compounds: (D:) Green fluorescence protein

SCOPe Domain Sequences for d2qled_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qled_ d.22.1.1 (D:) automated matches {Azotobacter vinelandii [TaxId: 354]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqvalskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d2qled_:

Click to download the PDB-style file with coordinates for d2qled_.
(The format of our PDB-style files is described here.)

Timeline for d2qled_: