SCOPe 2.07: Domain d2qled_: 2qle D:

Lineage for d2qled_ (2qle D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [188536] (1 PDB entry)

8. Domain d2qled_: 2qle D: [167706]
   Other proteins in same PDB: d2qlea2
   automated match to d1qyoa_
   complexed with imd; mutant

Details for d2qled_

PDB Entry: 2qle, 1.59 Å

PDB Description: gfp/s205v mutant

PDB Compounds: (D:) Green fluorescence protein

SCOPe Domain Sequences for d2qled_:

Sequence; same for both SEQRES and ATOM records:

>d2qled_ d.22.1.1 (D:) automated matches {Azotobacter vinelandii [TaxId: 354]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqvalskdpnekrdhmvllefvtaagith

Timeline for d2qled_:

• d2qled_ first appeared in SCOPe 2.01
  
• d2qled_ appears in SCOPe 2.06
  
• d2qled_ appears in the current release, SCOPe 2.08