Lineage for d2qkfd_ (2qkf D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086149Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)
  7. 2086264Species Neisseria meningitidis [TaxId:487] [188482] (1 PDB entry)
  8. 2086268Domain d2qkfd_: 2qkf D: [167698]
    automated match to d1d9ea_
    complexed with cl, gol, na

Details for d2qkfd_

PDB Entry: 2qkf (more details), 1.75 Å

PDB Description: Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (KDO8PS) from Neisseria meningitidis
PDB Compounds: (D:) 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase

SCOPe Domain Sequences for d2qkfd_:

Sequence, based on SEQRES records: (download)

>d2qkfd_ c.1.10.4 (D:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Neisseria meningitidis [TaxId: 487]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqtrdagsaasggrraqaldlalagmatrlaglfleshpd
pklakcdgpsalplhlledflirikalddliksqpil

Sequence, based on observed residues (ATOM records): (download)

>d2qkfd_ c.1.10.4 (D:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Neisseria meningitidis [TaxId: 487]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqtaqaldlalagmatrlaglfleshalplhlledfliri
kalddliksqpil

SCOPe Domain Coordinates for d2qkfd_:

Click to download the PDB-style file with coordinates for d2qkfd_.
(The format of our PDB-style files is described here.)

Timeline for d2qkfd_: