Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.15: KaiB-like [102449] (3 proteins) Pfam PF07689; contains members with alternative folds |
Protein automated matches [190797] (3 species) not a true protein |
Species Synechococcus elongatus [TaxId:32046] [188470] (1 PDB entry) |
Domain d2qked_: 2qke D: [167695] automated match to d1r5pb_ |
PDB Entry: 2qke (more details), 2.7 Å
SCOPe Domain Sequences for d2qked_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qked_ c.47.1.15 (D:) automated matches {Synechococcus elongatus [TaxId: 32046]} aplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkila tptlakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle
Timeline for d2qked_: