SCOPe 2.01: Domain d2qkeb_: 2qke B:

Lineage for d2qkeb_ (2qke B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.15: KaiB-like [102449] (3 proteins)
   Pfam PF07689; contains members with alternative folds

6. Protein automated matches [190797] (3 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:32046] [188470] (1 PDB entry)

8. Domain d2qkeb_: 2qke B: [167693]
   automated match to d1r5pb_

Details for d2qkeb_

PDB Entry: 2qke, 2.7 Å

PDB Description: Wild Type Crystal Structure of Full Length Circadian Clock Protein KaiB from Thermosynechococcus elongatus BP-1

PDB Compounds: (B:) Circadian clock protein kaiB

SCOPe Domain Sequences for d2qkeb_:

Sequence; same for both SEQRES and ATOM records:

>d2qkeb_ c.47.1.15 (B:) automated matches {Synechococcus elongatus [TaxId: 32046]}
maplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkil
atptlakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle

Timeline for d2qkeb_:

• d2qkeb_ is new in SCOPe 2.01-stable
  
• d2qkeb_ appears in SCOPe 2.02
  
• d2qkeb_ appears in the current release, SCOPe 2.08