Lineage for d2qjsb_ (2qjs B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996805Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries)
  8. 2996830Domain d2qjsb_: 2qjs B: [167686]
    automated match to d1smla_
    complexed with zn; mutant

Details for d2qjsb_

PDB Entry: 2qjs (more details), 2.25 Å

PDB Description: stenotrophomonas maltophilia l1 metallo-beta-lactamase asp-120 asn mutant
PDB Compounds: (B:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2qjsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjsb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
pmaplqiadhtwqigtedltallvqtpdgavlldggmpqmashlldnmkargvtprdlrl
illshahanhagpvaelkrrtgakvaanaesavllarggsddlhfgdgityppanadriv
mdgevitvggivftahfmaghtpgstawtwtdtrngkpvriayadslsapgyqlqgnpry
phliedyrrsfatvralpcdvlltphpgasnwdyaagaragakaltckayadaaeqkfdg
qlaketag

SCOPe Domain Coordinates for d2qjsb_:

Click to download the PDB-style file with coordinates for d2qjsb_.
(The format of our PDB-style files is described here.)

Timeline for d2qjsb_: