Lineage for d2qjla_ (2qjl A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018389Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 1018444Family d.15.3.0: automated matches [191373] (1 protein)
    not a true family
  6. 1018445Protein automated matches [190452] (1 species)
    not a true protein
  7. 1018446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187365] (2 PDB entries)
  8. 1018447Domain d2qjla_: 2qjl A: [167684]
    automated match to d1xo3a_
    complexed with edo, mg

Details for d2qjla_

PDB Entry: 2qjl (more details), 1.44 Å

PDB Description: Crystal structure of Urm1
PDB Compounds: (A:) Ubiquitin-related modifier 1

SCOPe Domain Sequences for d2qjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjla_ d.15.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvnvkveflggldaifgkqrvhkikmdkedpvtvgdlidhivstminnpndvsifiedds
irpgiitlindtdwelegekdyiledgdiisftstlhgg

SCOPe Domain Coordinates for d2qjla_:

Click to download the PDB-style file with coordinates for d2qjla_.
(The format of our PDB-style files is described here.)

Timeline for d2qjla_: