![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.3: MoaD/ThiS [54285] (5 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.3.0: automated matches [191373] (1 protein) not a true family |
![]() | Protein automated matches [190452] (4 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187365] (3 PDB entries) |
![]() | Domain d2qjla_: 2qjl A: [167684] automated match to d1xo3a_ complexed with edo, mg |
PDB Entry: 2qjl (more details), 1.44 Å
SCOPe Domain Sequences for d2qjla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjla_ d.15.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mvnvkveflggldaifgkqrvhkikmdkedpvtvgdlidhivstminnpndvsifiedds irpgiitlindtdwelegekdyiledgdiisftstlhgg
Timeline for d2qjla_: