SCOP 1.75: Domain d1mmob_: 1mmo B:

Lineage for d1mmob_ (1mmo B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)

8. Domain d1mmob_: 1mmo B: [16768]
   Other proteins in same PDB: d1mmod_, d1mmoe_, d1mmog_, d1mmoh_

Details for d1mmob_

PDB Entry: 1mmo, 2.2 Å

PDB Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane

PDB Compounds: (B:) methane monooxygenase hydrolase (beta chain)

SCOP Domain Sequences for d1mmob_:

Sequence; same for both SEQRES and ATOM records:

>d1mmob_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
gysadgqiramnptwrtsscnrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
dyasaidfkadrdqivkavlaglk

Timeline for d1mmob_:

• d1mmob_ first appeared (with stable ids) in SCOP 1.55
  
• d1mmob_ appears in SCOP 1.73
  
• d1mmob_ appears in SCOPe 2.01
  
• d1mmob_ appears in the current release, SCOPe 2.08