Lineage for d1mmob_ (1mmo B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279915Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 279992Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 279993Species Methylococcus capsulatus [TaxId:414] [88793] (15 PDB entries)
  8. 280012Domain d1mmob_: 1mmo B: [16768]
    Other proteins in same PDB: d1mmod_, d1mmoe_, d1mmog_, d1mmoh_

Details for d1mmob_

PDB Entry: 1mmo (more details), 2.2 Å

PDB Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane

SCOP Domain Sequences for d1mmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmob_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus}
errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
gysadgqiramnptwrtsscnrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
dyasaidfkadrdqivkavlaglk

SCOP Domain Coordinates for d1mmob_:

Click to download the PDB-style file with coordinates for d1mmob_.
(The format of our PDB-style files is described here.)

Timeline for d1mmob_: