Lineage for d2qjif_ (2qji F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836430Species Methanocaldococcus jannaschii [TaxId:2190] [188253] (3 PDB entries)
  8. 2836476Domain d2qjif_: 2qji F: [167669]
    automated match to d1ojxa_
    complexed with 13p, gol

Details for d2qjif_

PDB Entry: 2qji (more details), 2.8 Å

PDB Description: M. jannaschii ADH synthase complexed with dihydroxyacetone phosphate and glycerol
PDB Compounds: (F:) Putative aldolase MJ0400

SCOPe Domain Sequences for d2qjif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjif_ c.1.10.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
qhddvvgitravckivhenadveealkeirk

SCOPe Domain Coordinates for d2qjif_:

Click to download the PDB-style file with coordinates for d2qjif_.
(The format of our PDB-style files is described here.)

Timeline for d2qjif_: