SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qjie_ (2qji E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (69 species)
    not a true protein
  7. 2086730Species Methanocaldococcus jannaschii [TaxId:2190] [188253] (3 PDB entries)
  8. 2086775Domain d2qjie_: 2qji E: [167668]
    automated match to d1ojxa_
    complexed with 13p, gol

Details for d2qjie_

PDB Entry: 2qji (more details), 2.8 Å

PDB Description: M. jannaschii ADH synthase complexed with dihydroxyacetone phosphate and glycerol
PDB Compounds: (E:) Putative aldolase MJ0400

SCOPe Domain Sequences for d2qjie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjie_ c.1.10.0 (E:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
qhddvvgitravckivhenadveealkeirk

SCOPe Domain Coordinates for d2qjie_:

Click to download the PDB-style file with coordinates for d2qjie_.
(The format of our PDB-style files is described here.)

Timeline for d2qjie_: