Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (63 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [188253] (3 PDB entries) |
Domain d2qjid_: 2qji D: [167667] automated match to d1ojxa_ complexed with 13p, gol |
PDB Entry: 2qji (more details), 2.8 Å
SCOPe Domain Sequences for d2qjid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjid_ c.1.10.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif qhddvvgitravckivhenadveealkeirk
Timeline for d2qjid_: