Lineage for d2qjgp_ (2qjg P:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086730Species Methanocaldococcus jannaschii [TaxId:2190] [188253] (3 PDB entries)
  8. 2086746Domain d2qjgp_: 2qjg P: [167639]
    automated match to d1ojxa_
    complexed with f2p

Details for d2qjgp_

PDB Entry: 2qjg (more details), 2.6 Å

PDB Description: M. jannaschii ADH synthase complexed with F1,6P
PDB Compounds: (P:) Putative aldolase MJ0400

SCOPe Domain Sequences for d2qjgp_:

Sequence, based on SEQRES records: (download)

>d2qjgp_ c.1.10.0 (P:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
qhddvvgitravckivhenadveealkeir

Sequence, based on observed residues (ATOM records): (download)

>d2qjgp_ c.1.10.0 (P:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
vllhkgivrhghrgkdvgliihlsggtaispnplkkvivttveeairmgadavsihvnvg
sdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgadiv
ktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnifqh
ddvvgitravckivhenadveealkeir

SCOPe Domain Coordinates for d2qjgp_:

Click to download the PDB-style file with coordinates for d2qjgp_.
(The format of our PDB-style files is described here.)

Timeline for d2qjgp_: