Lineage for d2qind_ (2qin D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937673Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1937674Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1937791Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries)
  8. 1937800Domain d2qind_: 2qin D: [167622]
    automated match to d1smla_
    complexed with mg, zn; mutant

Details for d2qind_

PDB Entry: 2qin (more details), 1.76 Å

PDB Description: stenotrophomonas maltophilia l1 metallo-beta-lactamase asp-120 cys mutant
PDB Compounds: (D:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2qind_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qind_ d.157.1.1 (D:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
vplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmash
lldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsddl
hfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvriay
adslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaragak
altckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d2qind_:

Click to download the PDB-style file with coordinates for d2qind_.
(The format of our PDB-style files is described here.)

Timeline for d2qind_: