Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein automated matches [190654] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries) |
Domain d2qica_: 2qic A: [167617] automated match to d1wesa_ complexed with zn |
PDB Entry: 2qic (more details), 2.1 Å
SCOPe Domain Sequences for d2qica_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qica_ g.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eptyclcnqvsygemigcdndecpiewfhfscvglnhkpkgkwycpkcrge
Timeline for d2qica_: