SCOPe 2.01: Domain d2qhdb_: 2qhd B:

Lineage for d2qhdb_ (2qhd B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (3 PDB entries)

8. Domain d2qhdb_: 2qhd B: [167596]
   automated match to d1cl5a_
   complexed with dao

Details for d2qhdb_

PDB Entry: 2qhd, 1.95 Å

PDB Description: crystal structure of ecarpholin s (ser49-pla2) complexed with fatty acid

PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d2qhdb_:

Sequence; same for both SEQRES and ATOM records:

>d2qhdb_ a.133.1.2 (B:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
kc

Timeline for d2qhdb_:

• d2qhdb_ is new in SCOPe 2.01-stable
  
• d2qhdb_ appears in SCOPe 2.02
  
• d2qhdb_ appears in the current release, SCOPe 2.08