Lineage for d1fz0d_ (1fz0 D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279915Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 279992Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 279993Species Methylococcus capsulatus [TaxId:414] [88793] (15 PDB entries)
  8. 279999Domain d1fz0d_: 1fz0 D: [16759]
    Other proteins in same PDB: d1fz0a_, d1fz0b_, d1fz0e_, d1fz0f_
    complexed with ca, fe2

Details for d1fz0d_

PDB Entry: 1fz0 (more details), 2.07 Å

PDB Description: methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically

SCOP Domain Sequences for d1fz0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz0d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlagl

SCOP Domain Coordinates for d1fz0d_:

Click to download the PDB-style file with coordinates for d1fz0d_.
(The format of our PDB-style files is described here.)

Timeline for d1fz0d_: