Lineage for d1fz0d_ (1fz0 D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. Domain d1fz0d_: 1fz0 D: [16759]
    Other proteins in same PDB: d1fz0a_, d1fz0b_, d1fz0e_, d1fz0f_
    complexed with ca, fe2
    has additional insertions and/or extensions that are not grouped together

Details for d1fz0d_

PDB Entry: 1fz0 (more details), 2.07 Å

PDB Description: methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically
PDB Compounds: (D:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz0d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlagl

SCOPe Domain Coordinates for d1fz0d_ are not available.

Timeline for d1fz0d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fz0a_, d1fz0b_, d1fz0c_, d1fz0e_, d1fz0f_