Lineage for d2qgxc_ (2qgx C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2507955Protein automated matches [190124] (12 species)
    not a true protein
  7. 2507970Species Human (Homo sapiens) [TaxId:9606] [186848] (42 PDB entries)
  8. 2507991Domain d2qgxc_: 2qgx C: [167589]
    automated match to d1zuoa1

Details for d2qgxc_

PDB Entry: 2qgx (more details), 2.56 Å

PDB Description: Ubiquitin-conjugating enzyme E2Q
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 Q1

SCOPe Domain Sequences for d2qgxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qgxc_ d.20.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqilke
kegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssaysies
vimqisatlvkgkarvqfganksqysltraqqsykslvqih

SCOPe Domain Coordinates for d2qgxc_:

Click to download the PDB-style file with coordinates for d2qgxc_.
(The format of our PDB-style files is described here.)

Timeline for d2qgxc_: