Lineage for d2qgvh_ (2qgv H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878879Family c.47.1.20: HyaE-like [142401] (2 proteins)
    Pfam PF07449; have evolved a different function; contains no conserved cysteine residues
  6. 2878891Protein automated matches [190451] (1 species)
    not a true protein
  7. 2878892Species Shigella flexneri [TaxId:198214] [187364] (1 PDB entry)
  8. 2878900Domain d2qgvh_: 2qgv H: [167582]
    automated match to d2hfda1

Details for d2qgvh_

PDB Entry: 2qgv (more details), 2.7 Å

PDB Description: crystal structure of hydrogenase-1 operon protein hyae from shigella flexneri. northeast structural genomics consortium target sfr170
PDB Compounds: (H:) Hydrogenase-1 operon protein hyaE

SCOPe Domain Sequences for d2qgvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qgvh_ c.47.1.20 (H:) automated matches {Shigella flexneri [TaxId: 198214]}
tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
e

SCOPe Domain Coordinates for d2qgvh_:

Click to download the PDB-style file with coordinates for d2qgvh_.
(The format of our PDB-style files is described here.)

Timeline for d2qgvh_: