Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.20: HyaE-like [142401] (2 proteins) Pfam PF07449; have evolved a different function; contains no conserved cysteine residues |
Protein automated matches [190451] (1 species) not a true protein |
Species Shigella flexneri [TaxId:198214] [187364] (1 PDB entry) |
Domain d2qgvg_: 2qgv G: [167581] automated match to d2hfda1 |
PDB Entry: 2qgv (more details), 2.7 Å
SCOPe Domain Sequences for d2qgvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qgvg_ c.47.1.20 (G:) automated matches {Shigella flexneri [TaxId: 198214]} tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv e
Timeline for d2qgvg_: