Lineage for d2qgvf_ (2qgv F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457473Family c.47.1.20: HyaE-like [142401] (2 protein domains)
    Pfam PF07449; have evolved a different function; contains no conserved cysteine residues
  6. 2457485Protein automated matches [190451] (1 species)
    not a true protein
  7. 2457486Species Shigella flexneri [TaxId:198214] [187364] (1 PDB entry)
  8. 2457492Domain d2qgvf_: 2qgv F: [167580]
    automated match to d2hfda1

Details for d2qgvf_

PDB Entry: 2qgv (more details), 2.7 Å

PDB Description: crystal structure of hydrogenase-1 operon protein hyae from shigella flexneri. northeast structural genomics consortium target sfr170
PDB Compounds: (F:) Hydrogenase-1 operon protein hyaE

SCOPe Domain Sequences for d2qgvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qgvf_ c.47.1.20 (F:) automated matches {Shigella flexneri [TaxId: 198214]}
tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
e

SCOPe Domain Coordinates for d2qgvf_:

Click to download the PDB-style file with coordinates for d2qgvf_.
(The format of our PDB-style files is described here.)

Timeline for d2qgvf_: